PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0030s0126.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family G2-like
Protein Properties Length: 302aa    MW: 34276.6 Da    PI: 7.7963
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0030s0126.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.65e-32170225156
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                          k+r++W+peLH+rFv+a++qLGG e+AtPk+i+++m v+gLt+++vkSHLQkYRl+
  Kalax.0030s0126.1.p 170 KQRRCWSPELHQRFVDALKQLGGFEVATPKQIRDIMRVEGLTNDEVKSHLQKYRLH 225
                          79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.91E-17168228IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-28169228IPR009057Homeodomain-like
PROSITE profilePS5129410.312169227IPR017930Myb domain
TIGRFAMsTIGR015579.9E-26170225IPR006447Myb domain, plants
PfamPF002497.4E-7172223IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MDPGPTHDFL KIAPPVDDPP RRKLQGLADY LAGLEAERRK VEAFERELPL CLGLLNDAVE  60
RFREELRKCR EAVDRSFDKV RGPHSENVDD DRKNWMSSVQ LWNPHPDDSS EFNSSSSNLD  120
LMIGGCFGDG ISLNQLCGEN VRNPGKELIN ESKRQKRIQH QQAQQLVCRK QRRCWSPELH  180
QRFVDALKQL GGFEVATPKQ IRDIMRVEGL TNDEVKSHLQ KYRLHFRKAP STPMPATLNG  240
PTASRDDQLS TRLHSKSHSM YSPQGPLGRS SAMLDEGGDD ENEGHSWRNR VIFRPACMPT  300
C*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.11e-42G2-like family protein